Lineage for d3k7ua1 (3k7u A:6-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743768Domain d3k7ua1: 3k7u A:6-120 [179169]
    Other proteins in same PDB: d3k7ua2, d3k7ua3
    automated match to d1qd0a_

Details for d3k7ua1

PDB Entry: 3k7u (more details), 2.1 Å

PDB Description: Structure of essential protein from Trypanosoma brucei
PDB Compounds: (A:) antibody

SCOPe Domain Sequences for d3k7ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k7ua1 b.1.1.1 (A:6-120) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqaggsltlscaasgrtfsnnamgwfrqapgkerefvaaiswtggllfyadsvn
grftisrdnakrtvtlqmnslkpedtavyycaarpqgdyvtahydywgqgtqvtv

SCOPe Domain Coordinates for d3k7ua1:

Click to download the PDB-style file with coordinates for d3k7ua1.
(The format of our PDB-style files is described here.)

Timeline for d3k7ua1: