Lineage for d3k7sa_ (3k7s A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1885147Fold c.121: Ribose/Galactose isomerase RpiB/AlsB [89622] (1 superfamily)
    3 layers: a/b/a, core: parallel beta-sheet of 5 strands, order 21354; topological similarity to a part of the arginase/deacetylase fold
  4. 1885148Superfamily c.121.1: Ribose/Galactose isomerase RpiB/AlsB [89623] (2 families) (S)
  5. 1885200Family c.121.1.0: automated matches [191649] (1 protein)
    not a true family
  6. 1885201Protein automated matches [191196] (7 species)
    not a true protein
  7. 1885237Species Trypanosoma cruzi [TaxId:353153] [189510] (4 PDB entries)
  8. 1885240Domain d3k7sa_: 3k7s A: [179165]
    automated match to d1nn4b_
    complexed with r52

Details for d3k7sa_

PDB Entry: 3k7s (more details), 1.9 Å

PDB Description: Complex of Trypanosoma cruzi ribose 5-phosphate isomerase type B with ribose 5-phosphate
PDB Compounds: (A:) Ribose 5-phosphate isomerase

SCOPe Domain Sequences for d3k7sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k7sa_ c.121.1.0 (A:) automated matches {Trypanosoma cruzi [TaxId: 353153]}
mtrrvaigtdhpafaihenlilyvkeagdefvpvycgpktaesvdypdfasrvaemvark
evefgvlacgsgigmsiaankvpgvraalchdhytaamsrihndanivcvgerttgvevi
reiiitflqtpfsgeerhvrriekiraieash

SCOPe Domain Coordinates for d3k7sa_:

Click to download the PDB-style file with coordinates for d3k7sa_.
(The format of our PDB-style files is described here.)

Timeline for d3k7sa_: