Lineage for d3k7rl_ (3k7r L:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560728Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2560729Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2560730Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species)
  7. 2560731Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries)
  8. 2560745Domain d3k7rl_: 3k7r L: [179164]
    automated match to d1fd8a_
    complexed with 4sm, cu, mlt

Details for d3k7rl_

PDB Entry: 3k7r (more details), 2.28 Å

PDB Description: crystal structure of [tm][cuatx1]3
PDB Compounds: (L:) Metal homeostasis factor ATX1

SCOPe Domain Sequences for d3k7rl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k7rl_ d.58.17.1 (L:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik
ktgkevrs

SCOPe Domain Coordinates for d3k7rl_:

Click to download the PDB-style file with coordinates for d3k7rl_.
(The format of our PDB-style files is described here.)

Timeline for d3k7rl_: