Lineage for d3k7rj_ (3k7r J:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417028Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 1417029Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 1417030Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 1417031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries)
  8. 1417043Domain d3k7rj_: 3k7r J: [179162]
    automated match to d1fd8a_
    complexed with 4sm, cu, mlt

Details for d3k7rj_

PDB Entry: 3k7r (more details), 2.28 Å

PDB Description: crystal structure of [tm][cuatx1]3
PDB Compounds: (J:) Metal homeostasis factor ATX1

SCOPe Domain Sequences for d3k7rj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k7rj_ d.58.17.1 (J:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik
ktgkevrsgkql

SCOPe Domain Coordinates for d3k7rj_:

Click to download the PDB-style file with coordinates for d3k7rj_.
(The format of our PDB-style files is described here.)

Timeline for d3k7rj_: