Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) |
Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins) |
Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries) |
Domain d3k7rj_: 3k7r J: [179162] automated match to d1fd8a_ complexed with 4sm, cu, mlt |
PDB Entry: 3k7r (more details), 2.28 Å
SCOPe Domain Sequences for d3k7rj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k7rj_ d.58.17.1 (J:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik ktgkevrsgkql
Timeline for d3k7rj_: