SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3k7rh_ (3k7r H:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2176148Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2176149Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 protein domains)
  6. 2176150Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)
  7. 2176151Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries)
  8. 2176161Domain d3k7rh_: 3k7r H: [179160]
    automated match to d1fd8a_
    complexed with 4sm, cu, mlt

Details for d3k7rh_

PDB Entry: 3k7r (more details), 2.28 Å

PDB Description: Crystal structure of [TM][CuAtx1]3
PDB Compounds: (H:) Metal homeostasis factor ATX1

SCOPe Domain Sequences for d3k7rh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k7rh_ d.58.17.1 (H:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekikkt
gkevrsgkql

SCOPe Domain Coordinates for d3k7rh_:

Click to download the PDB-style file with coordinates for d3k7rh_.
(The format of our PDB-style files is described here.)

Timeline for d3k7rh_: