SCOP 1.63: Domain d1ffvd1: 1ffv D:82-157

Lineage for d1ffvd1 (1ffv D:82-157)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)

6. Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (2 species)

7. Species Hydrogenophaga pseudoflava [TaxId:47421] [47750] (2 PDB entries)

8. Domain d1ffvd1: 1ffv D:82-157 [17916]
   Other proteins in same PDB: d1ffva2, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd2, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2
   complexed with aro, csz, fad, fes, pcd

Details for d1ffvd1

PDB Entry: 1ffv, 2.25 Å

PDB Description: carbon monoxide dehydrogenase from hydrogenophaga pseudoflava

SCOP Domain Sequences for d1ffvd1:

Sequence; same for both SEQRES and ATOM records:

>d1ffvd1 a.56.1.1 (D:82-157) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava}
nkgvlhavqegfykehglqcgfctpgmlmrayrflqenpnpteaeirmgmtgnlcrctgy
qnivkavqyaarklqe

Timeline for d1ffvd1:

• d1ffvd1 first appeared (with stable ids) in SCOP 1.55
  
• d1ffvd1 appears in SCOP 1.61
  
• d1ffvd1 appears in SCOP 1.65
  
• d1ffvd1 appears in the current release, SCOPe 2.08