![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
![]() | Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) ![]() contains 2Fe-2S cluster |
![]() | Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins) |
![]() | Protein Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain [47748] (3 species) |
![]() | Species Hydrogenophaga pseudoflava [TaxId:47421] [47750] (2 PDB entries) |
![]() | Domain d1ffvd1: 1ffv D:82-157 [17916] Other proteins in same PDB: d1ffva2, d1ffvb1, d1ffvb2, d1ffvc1, d1ffvc2, d1ffvd2, d1ffve1, d1ffve2, d1ffvf1, d1ffvf2 complexed with fad, fes, pcd |
PDB Entry: 1ffv (more details), 2.25 Å
SCOPe Domain Sequences for d1ffvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffvd1 a.56.1.1 (D:82-157) Carbon monoxide (CO) dehydrogenase iron-sulfur protein, C-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} nkgvlhavqegfykehglqcgfctpgmlmrayrflqenpnpteaeirmgmtgnlcrctgy qnivkavqyaarklqe
Timeline for d1ffvd1: