Lineage for d3k7re_ (3k7r E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2953868Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2953869Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)
  6. 2953870Protein ATX1 metallochaperone protein (ATOX1) [55014] (3 species)
  7. 2953871Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries)
  8. 2953878Domain d3k7re_: 3k7r E: [179157]
    automated match to d1fd8a_
    complexed with 4sm, cu, mlt

Details for d3k7re_

PDB Entry: 3k7r (more details), 2.28 Å

PDB Description: crystal structure of [tm][cuatx1]3
PDB Compounds: (E:) Metal homeostasis factor ATX1

SCOPe Domain Sequences for d3k7re_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k7re_ d.58.17.1 (E:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aeikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekik
ktgkevrsgkql

SCOPe Domain Coordinates for d3k7re_:

Click to download the PDB-style file with coordinates for d3k7re_.
(The format of our PDB-style files is described here.)

Timeline for d3k7re_: