SCOPe 2.06: Domain d3k7ra_: 3k7r A:

Lineage for d3k7ra_ (3k7r A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families)

5. Family d.58.17.1: HMA, heavy metal-associated domain [55009] (9 proteins)

6. Protein ATX1 metallochaperone protein (ATOX1) [55014] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55015] (6 PDB entries)

8. Domain d3k7ra_: 3k7r A: [179153]
   automated match to d1fd8a_
   complexed with 4sm, cu, mlt

Details for d3k7ra_

PDB Entry: 3k7r, 2.28 Å

PDB Description: crystal structure of [tm][cuatx1]3

PDB Compounds: (A:) Metal homeostasis factor ATX1

SCOPe Domain Sequences for d3k7ra_:

Sequence; same for both SEQRES and ATOM records:

>d3k7ra_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eikhyqfnvvmtcsgcsgavnkvltklepdvskidislekqlvdvyttlpydfilekikk
tgkevrsgkq

Timeline for d3k7ra_:

• d3k7ra_ first appeared in SCOPe 2.01
  
• d3k7ra_ appears in SCOPe 2.05
  
• d3k7ra_ appears in SCOPe 2.07
  
• d3k7ra_ appears in the current release, SCOPe 2.08