SCOPe 2.08: Domain d3k79a1: 3k79 A:2-57

Lineage for d3k79a1 (3k79 A:2-57)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.1: ROP protein [47380] (1 family)
   automatically mapped to Pfam PF01815

5. Family a.30.1.1: ROP protein [47381] (1 protein)

6. Protein ROP protein [47382] (1 species)

7. Species Escherichia coli [TaxId:562] [47383] (18 PDB entries)
   Uniprot P03051

8. Domain d3k79a1: 3k79 A:2-57 [179147]
   Other proteins in same PDB: d3k79a2
   automated match to d1rpra_

Details for d3k79a1

PDB Entry: 3k79, 1.96 Å

PDB Description: c38a, c52v cysteine-free variant of rop (rom)

PDB Compounds: (A:) Regulatory protein rop

SCOPe Domain Sequences for d3k79a1:

Sequence; same for both SEQRES and ATOM records:

>d3k79a1 a.30.1.1 (A:2-57) ROP protein {Escherichia coli [TaxId: 562]}
tkqektalnmarfirsqtltlleklneldadeqadiaeslhdhadelyrsvlarfg

Timeline for d3k79a1:

• d3k79a1 first appeared in SCOPe 2.01, called d3k79a_
  
• d3k79a1 appears in SCOPe 2.07