| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.30: ROP-like [47379] (8 superfamilies) 4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist |
Superfamily a.30.1: ROP protein [47380] (1 family) ![]() automatically mapped to Pfam PF01815 |
| Family a.30.1.1: ROP protein [47381] (1 protein) |
| Protein ROP protein [47382] (1 species) |
| Species Escherichia coli [TaxId:562] [47383] (18 PDB entries) Uniprot P03051 |
| Domain d3k79a1: 3k79 A:2-57 [179147] Other proteins in same PDB: d3k79a2 automated match to d1rpra_ |
PDB Entry: 3k79 (more details), 1.96 Å
SCOPe Domain Sequences for d3k79a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k79a1 a.30.1.1 (A:2-57) ROP protein {Escherichia coli [TaxId: 562]}
tkqektalnmarfirsqtltlleklneldadeqadiaeslhdhadelyrsvlarfg
Timeline for d3k79a1: