Lineage for d3k77g_ (3k77 G:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046279Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2046280Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2046652Family b.18.1.8: N-terminal domain of xrcc1 [49814] (1 protein)
    automatically mapped to Pfam PF01834
  6. 2046653Protein N-terminal domain of xrcc1 [49815] (1 species)
    the single-strand break repair protein
  7. 2046654Species Human (Homo sapiens) [TaxId:9606] [49816] (5 PDB entries)
  8. 2046662Domain d3k77g_: 3k77 G: [179144]
    automated match to d1xnaa_

Details for d3k77g_

PDB Entry: 3k77 (more details), 2.6 Å

PDB Description: x-ray crystal structure of xrcc1
PDB Compounds: (G:) DNA repair protein XRCC1

SCOPe Domain Sequences for d3k77g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k77g_ b.18.1.8 (G:) N-terminal domain of xrcc1 {Human (Homo sapiens) [TaxId: 9606]}
peirlrhvvscssqdsthcaenllkadtyrkwraakagektisvvlqlekeeqihsvdig
ndgsafvevlvgssaggageqdyevllvtssfmspsesrsgsnpnrvrmfgpdklvraaa
ekrwdrvkivcsqpyskdspfglsfvrfhspp

SCOPe Domain Coordinates for d3k77g_:

Click to download the PDB-style file with coordinates for d3k77g_.
(The format of our PDB-style files is described here.)

Timeline for d3k77g_: