![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.8: N-terminal domain of xrcc1 [49814] (1 protein) automatically mapped to Pfam PF01834 |
![]() | Protein N-terminal domain of xrcc1 [49815] (1 species) the single-strand break repair protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49816] (5 PDB entries) |
![]() | Domain d3k77e_: 3k77 E: [179142] automated match to d1xnaa_ |
PDB Entry: 3k77 (more details), 2.6 Å
SCOPe Domain Sequences for d3k77e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k77e_ b.18.1.8 (E:) N-terminal domain of xrcc1 {Human (Homo sapiens) [TaxId: 9606]} peirlrhvvscssqdsthcaenllkadtyrkwraakagektisvvlqlekeeqihsvdig ndgsafvevlvgssaggageqdyevllvtssfmspsesrsgsnpnrvrmfgpdklvraaa ekrwdrvkivcsqpyskdspfglsfvrfhspp
Timeline for d3k77e_: