SCOPe 2.08: Domain d3k6na_: 3k6n A:

Lineage for d3k6na_ (3k6n A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)

6. Protein automated matches [190782] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries)

8. Domain d3k6na_: 3k6n A: [179134]
   automated match to d1n9pa_
   complexed with na; mutant

Details for d3k6na_

PDB Entry: 3k6n, 2 Å

PDB Description: crystal structure of the s225e mutant kir3.1 cytoplasmic pore domain

PDB Compounds: (A:) G protein-activated inward rectifier potassium channel 1

SCOPe Domain Sequences for d3k6na_:

Sequence, based on SEQRES records:

>d3k6na_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qrfvdkngrcnvqhgnlgseraetlmfsehavismrdgkltlmfrvgnlrnshmveaqir
ckllksrqtpegeflpldqleldvgfstgadqlflvspltichvidakspfydlsqrsmq
teqfevvvilegivettgmtcqartsytedevlwghrffpvisleegffkvdysqfhatf
evptppysvkeqeemllms

Sequence, based on observed residues (ATOM records):

>d3k6na_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qrfvdkngrcnvqhtlmfsehavismrdgkltlmfrvgnveaqirckllksrqtpegefl
pldqleldvgfstgadqlflvspltichvidakspfydlsqrsmqteqfevvvilegigm
tcqartsytedevlwghrffpvisfkvdysqfhatfevptppysvkeqeemllms

Timeline for d3k6na_:

• d3k6na_ first appeared in SCOPe 2.01
  
• d3k6na_ appears in SCOPe 2.07