![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
![]() | Superfamily d.37.1: CBS-domain pair [54631] (2 families) ![]() |
![]() | Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
![]() | Protein automated matches [191100] (13 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189092] (1 PDB entry) |
![]() | Domain d3k6eb_: 3k6e B: [179130] automated match to d1yava3 complexed with po4 |
PDB Entry: 3k6e (more details), 2.81 Å
SCOPe Domain Sequences for d3k6eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k6eb_ d.37.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} namiakefetfllgqeetfltpaknlavlidthnadhatlllsqmtytrvpvvtdekqfv gtiglrdimayqmehdlsqeimadtdivhmtktdvavvspdftitevlhklvdesflpvv daegifqgiitrksilkavnallhdfskeyeir
Timeline for d3k6eb_: