Lineage for d3k6eb_ (3k6e B:)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.37: CBS-domain pair [54630] (1 superfamily)
duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/aSuperfamily d.37.1: CBS-domain pair [54631] (2 families) 
Family d.37.1.0: automated matches [191603] (1 protein)
not a true familyProtein automated matches [191100] (13 species)
not a true protein
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189092] (1 PDB entry) 
Domain d3k6eb_: 3k6e B: [179130]
automated match to d1yava3
complexed with po4
Details for d3k6eb_
PDB Entry: 3k6e (more details), 2.81 Å
PDB Description: crystal structure of cbs domain protein from streptococcus pneumoniae tigr4
PDB Compounds: (B:) CBS domain proteinSCOPe Domain Sequences for d3k6eb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k6eb_ d.37.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
namiakefetfllgqeetfltpaknlavlidthnadhatlllsqmtytrvpvvtdekqfv
gtiglrdimayqmehdlsqeimadtdivhmtktdvavvspdftitevlhklvdesflpvv
daegifqgiitrksilkavnallhdfskeyeir
SCOPe Domain Coordinates for d3k6eb_:
Click to download the PDB-style file with coordinates for d3k6eb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3k6eb_:
- d3k6eb_ first appeared in SCOPe 2.01
- d3k6eb_ appears in SCOPe 2.04
- d3k6eb_ is called d3k6eb1 in SCOPe 2.06
- d3k6eb_ appears in the current release, SCOPe 2.08, called d3k6eb1
View in 3D
