Lineage for d1fiqa1 (1fiq A:93-165)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715311Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 2715312Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
    Uniprot P80457
  8. 2715333Domain d1fiqa1: 1fiq A:93-165 [17912]
    Other proteins in same PDB: d1fiqa2, d1fiqb1, d1fiqb2, d1fiqc1, d1fiqc2
    complexed with fad, fes, gol, mos, mte, sal

Details for d1fiqa1

PDB Entry: 1fiq (more details), 2.5 Å

PDB Description: crystal structure of xanthine oxidase from bovine milk
PDB Compounds: (A:) xanthine oxidase

SCOPe Domain Sequences for d1fiqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiqa1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d1fiqa1:

Click to download the PDB-style file with coordinates for d1fiqa1.
(The format of our PDB-style files is described here.)

Timeline for d1fiqa1: