Lineage for d3k6ae_ (3k6a E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1862514Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 1862515Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 1862516Family c.57.1.1: MogA-like [53219] (6 proteins)
  6. 1862534Protein MogA [53220] (3 species)
  7. 1862545Species Shewanella oneidensis [TaxId:70863] [142541] (2 PDB entries)
    Uniprot Q8EKM7 2-174
  8. 1862550Domain d3k6ae_: 3k6a E: [179117]
    automated match to d3k6aa_
    complexed with na

Details for d3k6ae_

PDB Entry: 3k6a (more details), 1.89 Å

PDB Description: Crystal structure of molybdenum cofactor biosynthesis protein mog from shewanella oneidensis
PDB Compounds: (E:) molybdenum cofactor biosynthesis protein Mog

SCOPe Domain Sequences for d3k6ae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k6ae_ c.57.1.1 (E:) MogA {Shewanella oneidensis [TaxId: 70863]}
kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma
deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag
lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfr

SCOPe Domain Coordinates for d3k6ae_:

Click to download the PDB-style file with coordinates for d3k6ae_.
(The format of our PDB-style files is described here.)

Timeline for d3k6ae_: