Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) |
Family c.57.1.1: MogA-like [53219] (6 proteins) |
Protein MogA [53220] (3 species) |
Species Shewanella oneidensis [TaxId:70863] [142541] (2 PDB entries) Uniprot Q8EKM7 2-174 |
Domain d3k6ae_: 3k6a E: [179117] automated match to d3k6aa_ complexed with na |
PDB Entry: 3k6a (more details), 1.89 Å
SCOPe Domain Sequences for d3k6ae_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k6ae_ c.57.1.1 (E:) MogA {Shewanella oneidensis [TaxId: 70863]} kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfr
Timeline for d3k6ae_: