![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.1: MogA-like [53219] (6 proteins) |
![]() | Protein MogA [53220] (3 species) |
![]() | Species Shewanella oneidensis [TaxId:70863] [142541] (3 PDB entries) Uniprot Q8EKM7 2-174 |
![]() | Domain d3k6ab_: 3k6a B: [179114] Other proteins in same PDB: d3k6aa2 automated match to d3k6aa_ complexed with na |
PDB Entry: 3k6a (more details), 1.89 Å
SCOPe Domain Sequences for d3k6ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k6ab_ c.57.1.1 (B:) MogA {Shewanella oneidensis [TaxId: 70863]} kakigivtvsdrasagiyedisgkaiidtlndyltsewepiyqvipdeqdviettlikma deqdcclivttggtgpakrdvtpeateavcdrmmpgfgelmraeslkfvptailsrqtag lrgdslivnlpgkpksirecldavfpaipycidlmegpylecneavikpfrp
Timeline for d3k6ab_: