Lineage for d3k69a_ (3k69 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694842Species Lactobacillus plantarum [TaxId:1590] [189101] (1 PDB entry)
  8. 2694843Domain d3k69a_: 3k69 A: [179112]
    automated match to d1ylfa1
    complexed with dms

Details for d3k69a_

PDB Entry: 3k69 (more details), 1.95 Å

PDB Description: crystal structure of a putative transcriptional regulator (lp_0360) from lactobacillus plantarum at 1.95 a resolution
PDB Compounds: (A:) putative transcription regulator

SCOPe Domain Sequences for d3k69a_:

Sequence, based on SEQRES records: (download)

>d3k69a_ a.4.5.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
mkldfsvavhsilyldahrdskvasrelaqslhlnpvmirnilsvlhkhgyltgtvgkng
gyqldlaladmnlgdlydltipptisyarfitgpsktdeqadqspiaanisetltdlftv
adrqyrayyhqftmadlqadlnhhgtflqheqdse

Sequence, based on observed residues (ATOM records): (download)

>d3k69a_ a.4.5.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 1590]}
mkldfsvavhsilyldahrdskvasrelaqslhlnpvmirnilsvlhkhgyltgtvgkng
gyqldlaladmnlgdlydltipptisyarfitgpskadqspiaanisetltdlftvadrq
yrayyhqftmadlqadlnhhgtflqheqdse

SCOPe Domain Coordinates for d3k69a_:

Click to download the PDB-style file with coordinates for d3k69a_.
(The format of our PDB-style files is described here.)

Timeline for d3k69a_: