SCOPe 2.05: Domain d3k67b_: 3k67 B:

Lineage for d3k67b_ (3k67 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.4: MaoC-like [82636] (6 proteins)

6. Protein Hypothetical protein AF1124 [143171] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [143172] (2 PDB entries)
   Uniprot O29141 6-159

8. Domain d3k67b_: 3k67 B: [179111]
   automated match to d2b3ma1
   complexed with po4

Details for d3k67b_

PDB Entry: 3k67, 1.25 Å

PDB Description: Crystal structure of protein af1124 from archaeoglobus fulgidus

PDB Compounds: (B:) putative dehydratase AF1124

SCOPe Domain Sequences for d3k67b_:

Sequence; same for both SEQRES and ATOM records:

>d3k67b_ d.38.1.4 (B:) Hypothetical protein AF1124 {Archaeoglobus fulgidus [TaxId: 2234]}
gevkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdl
npvhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvr
vegvvsgveknrytidvkcytgdkvvaegvvkvliw

Timeline for d3k67b_:

• d3k67b_ first appeared in SCOPe 2.01
  
• d3k67b_ appears in SCOPe 2.04
  
• d3k67b_ appears in SCOPe 2.06
  
• d3k67b_ appears in the current release, SCOPe 2.08