Lineage for d3k67a_ (3k67 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943777Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 2943825Protein Hypothetical protein AF1124 [143171] (1 species)
  7. 2943826Species Archaeoglobus fulgidus [TaxId:2234] [143172] (3 PDB entries)
    Uniprot O29141 6-159
  8. 2943827Domain d3k67a_: 3k67 A: [179110]
    automated match to d2b3ma1
    complexed with po4

Details for d3k67a_

PDB Entry: 3k67 (more details), 1.25 Å

PDB Description: Crystal structure of protein af1124 from archaeoglobus fulgidus
PDB Compounds: (A:) putative dehydratase AF1124

SCOPe Domain Sequences for d3k67a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k67a_ d.38.1.4 (A:) Hypothetical protein AF1124 {Archaeoglobus fulgidus [TaxId: 2234]}
gevkmmslleemkgiyskkggkvkpfekfegelkegyrfeyekklceidvamfglisgdl
npvhfdedfasktrfggrvvhgmlttslvsaavarlpgtvvlleqsfrytspvrigdvvr
vegvvsgveknrytidvkcytgdkvvaegvvkvliw

SCOPe Domain Coordinates for d3k67a_:

Click to download the PDB-style file with coordinates for d3k67a_.
(The format of our PDB-style files is described here.)

Timeline for d3k67a_: