Lineage for d3k60b_ (3k60 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973216Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2973542Protein automated matches [190229] (13 species)
    not a true protein
  7. 2973744Species Plasmodium falciparum [TaxId:36329] [189412] (1 PDB entry)
  8. 2973746Domain d3k60b_: 3k60 B: [179108]
    automated match to d1uy6a_
    complexed with adp, so4

Details for d3k60b_

PDB Entry: 3k60 (more details), 2.3 Å

PDB Description: crystal structure of n-terminal domain of plasmodium falciparum hsp90 (pf07_0029) bound to adp
PDB Compounds: (B:) Heat shock protein 86

SCOPe Domain Sequences for d3k60b_:

Sequence, based on SEQRES records: (download)

>d3k60b_ d.122.1.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
stetfafnadirqlmsliintfysnkeiflrelisnasdaldkiryesitdtqklsaepe
ffiriipdktnntltiedsgigmtkndlinnlgtiarsgtkafmeaiqasgdismigqfg
vgfysaylvadhvvvisknnddeqyvwesaaggsftvtkdetneklgrgtkiilhlkedq
leyleekrikdlvkkhsefisfpiklycergggveheweeln

Sequence, based on observed residues (ATOM records): (download)

>d3k60b_ d.122.1.1 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
stetfafnadirqlmsliintfysnkeiflrelisnasdaldkiryesitdtqklsaepe
ffiriipdktnntltiedsgigmtkndlinnlgtiarsgtkafmeaiqasgdismigqfg
vgfysaylvadhvvvisknnddeqyvwesaaggsftvtkdetneklgrgtkiilhlkedq
leyleekrikdlvkkhsefisfpiklyceheweeln

SCOPe Domain Coordinates for d3k60b_:

Click to download the PDB-style file with coordinates for d3k60b_.
(The format of our PDB-style files is described here.)

Timeline for d3k60b_: