Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187169] (38 PDB entries) |
Domain d3k5va1: 3k5v A:248-529 [179105] Other proteins in same PDB: d3k5va2, d3k5vb2 automated match to d1opjb_ complexed with cl, sti, stj |
PDB Entry: 3k5v (more details), 1.74 Å
SCOPe Domain Sequences for d3k5va1:
Sequence, based on SEQRES records: (download)
>d3k5va1 d.144.1.7 (A:248-529) automated matches {Mouse (Mus musculus) [TaxId: 10090]} spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa vmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqis sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv yelmracwqwnpsdrpsfaeihqafetmfqessisdevekel
>d3k5va1 d.144.1.7 (A:248-529) automated matches {Mouse (Mus musculus) [TaxId: 10090]} spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedmeveeflkeaav mkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqiss ameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtape slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy elmracwqwnpsdrpsfaeihqafetmfqessisdevekel
Timeline for d3k5va1: