SCOP 1.65: Domain d1dgja1: 1dgj A:81-193

Lineage for d1dgja1 (1dgj A:81-193)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)

6. Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)

7. Species Desulfovibrio desulfuricans [TaxId:876] [47745] (1 PDB entry)

8. Domain d1dgja1: 1dgj A:81-193 [17909]
   Other proteins in same PDB: d1dgja2, d1dgja3, d1dgja4
   complexed with 2mo, fes, mcn

Details for d1dgja1

PDB Entry: 1dgj, 2.8 Å

PDB Description: crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774

SCOP Domain Sequences for d1dgja1:

Sequence; same for both SEQRES and ATOM records:

>d1dgja1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio desulfuricans}
apdclhplqhawiqhgaaqcgfctpgfivsakalldenvapsredvrdwfqkhhnicrct
gykplvdavmdaaailrgektveeisfkmpadgriwgssiprpsavakvtgla

Timeline for d1dgja1:

• d1dgja1 first appeared (with stable ids) in SCOP 1.55
  
• d1dgja1 appears in SCOP 1.63
  
• d1dgja1 appears in SCOP 1.67
  
• d1dgja1 appears in the current release, SCOPe 2.08