Lineage for d1dgja1 (1dgj A:81-193)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48597Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
  4. 48598Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
  5. 48599Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (3 proteins)
  6. 48600Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 48601Species Desulfovibrio desulfuricans [TaxId:876] [47745] (1 PDB entry)
  8. 48602Domain d1dgja1: 1dgj A:81-193 [17909]
    Other proteins in same PDB: d1dgja2, d1dgja3, d1dgja4

Details for d1dgja1

PDB Entry: 1dgj (more details), 2.8 Å

PDB Description: crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774

SCOP Domain Sequences for d1dgja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgja1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio desulfuricans}
apdclhplqhawiqhgaaqcgfctpgfivsakalldenvapsredvrdwfqkhhnicrct
gykplvdavmdaaailrgektveeisfkmpadgriwgssiprpsavakvtgla

SCOP Domain Coordinates for d1dgja1:

Click to download the PDB-style file with coordinates for d1dgja1.
(The format of our PDB-style files is described here.)

Timeline for d1dgja1: