![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Wolinella succinogenes [TaxId:844] [189100] (1 PDB entry) |
![]() | Domain d3k4uf1: 3k4u F:2-233 [179085] Other proteins in same PDB: d3k4ua2, d3k4ub2, d3k4uc2, d3k4ud2, d3k4ue2, d3k4uf2 automated match to d1wdna_ complexed with lys |
PDB Entry: 3k4u (more details), 2.62 Å
SCOPe Domain Sequences for d3k4uf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k4uf1 c.94.1.0 (F:2-233) automated matches {Wolinella succinogenes [TaxId: 844]} rgelrvglepgylpfemkdkkgnvigfdvdlaremakamgvklklvptswdglipglvte kfdiiisgmtisqernlrvnfvepyivvgqsllvkkglekgvksykdldkpeltlvtkfg vsaeyaakrlfknaklktydteaeavqevlngkadmfifdlpfnvafmaqkgqgylvhld tsltyeplgwaikkgdpdflnwlnhflaqikhdgsydelyerwfvdtkwlek
Timeline for d3k4uf1: