Lineage for d3k4ue1 (3k4u E:2-233)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916436Species Wolinella succinogenes [TaxId:844] [189100] (1 PDB entry)
  8. 2916441Domain d3k4ue1: 3k4u E:2-233 [179084]
    Other proteins in same PDB: d3k4ua2, d3k4ub2, d3k4uc2, d3k4ud2, d3k4ue2, d3k4uf2
    automated match to d1wdna_
    complexed with lys

Details for d3k4ue1

PDB Entry: 3k4u (more details), 2.62 Å

PDB Description: crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
PDB Compounds: (E:) binding component of abc transporter

SCOPe Domain Sequences for d3k4ue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4ue1 c.94.1.0 (E:2-233) automated matches {Wolinella succinogenes [TaxId: 844]}
rgelrvglepgylpfemkdkkgnvigfdvdlaremakamgvklklvptswdglipglvte
kfdiiisgmtisqernlrvnfvepyivvgqsllvkkglekgvksykdldkpeltlvtkfg
vsaeyaakrlfknaklktydteaeavqevlngkadmfifdlpfnvafmaqkgqgylvhld
tsltyeplgwaikkgdpdflnwlnhflaqikhdgsydelyerwfvdtkwlek

SCOPe Domain Coordinates for d3k4ue1:

Click to download the PDB-style file with coordinates for d3k4ue1.
(The format of our PDB-style files is described here.)

Timeline for d3k4ue1: