SCOPe 2.01: Domain d3k4uc_: 3k4u C:

Lineage for d3k4uc_ (3k4u C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (20 species)
   not a true protein

7. Species Wolinella succinogenes [TaxId:844] [189100] (1 PDB entry)

8. Domain d3k4uc_: 3k4u C: [179082]
   automated match to d1wdna_
   complexed with lys

Details for d3k4uc_

PDB Entry: 3k4u, 2.62 Å

PDB Description: crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine

PDB Compounds: (C:) binding component of abc transporter

SCOPe Domain Sequences for d3k4uc_:

Sequence; same for both SEQRES and ATOM records:

>d3k4uc_ c.94.1.0 (C:) automated matches {Wolinella succinogenes [TaxId: 844]}
lrgelrvglepgylpfemkdkkgnvigfdvdlaremakamgvklklvptswdglipglvt
ekfdiiisgmtisqernlrvnfvepyivvgqsllvkkglekgvksykdldkpeltlvtkf
gvsaeyaakrlfknaklktydteaeavqevlngkadmfifdlpfnvafmaqkgqgylvhl
dtsltyeplgwaikkgdpdflnwlnhflaqikhdgsydelyerwfvdtkwlek

Timeline for d3k4uc_:

• d3k4uc_ is new in SCOPe 2.01-stable
  
• d3k4uc_ appears in SCOPe 2.02
  
• d3k4uc_ appears in the current release, SCOPe 2.08, called d3k4uc1