SCOPe 2.06: Domain d3k4ua1: 3k4u A:2-233

Lineage for d3k4ua1 (3k4u A:2-233)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Wolinella succinogenes [TaxId:844] [189100] (1 PDB entry)

8. Domain d3k4ua1: 3k4u A:2-233 [179080]
   Other proteins in same PDB: d3k4ua2, d3k4ub2, d3k4uc2, d3k4ud2, d3k4ue2, d3k4uf2
   automated match to d1wdna_
   complexed with lys

Details for d3k4ua1

PDB Entry: 3k4u, 2.62 Å

PDB Description: crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine

PDB Compounds: (A:) binding component of abc transporter

SCOPe Domain Sequences for d3k4ua1:

Sequence; same for both SEQRES and ATOM records:

>d3k4ua1 c.94.1.0 (A:2-233) automated matches {Wolinella succinogenes [TaxId: 844]}
rgelrvglepgylpfemkdkkgnvigfdvdlaremakamgvklklvptswdglipglvte
kfdiiisgmtisqernlrvnfvepyivvgqsllvkkglekgvksykdldkpeltlvtkfg
vsaeyaakrlfknaklktydteaeavqevlngkadmfifdlpfnvafmaqkgqgylvhld
tsltyeplgwaikkgdpdflnwlnhflaqikhdgsydelyerwfvdtkwlek

Timeline for d3k4ua1:

• d3k4ua1 first appeared in SCOPe 2.01, called d3k4ua_
  
• d3k4ua1 was called d3k4ua_ in SCOPe 2.05
  
• d3k4ua1 appears in SCOPe 2.07
  
• d3k4ua1 appears in the current release, SCOPe 2.08