Lineage for d3k4ua_ (3k4u A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1880254Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 1880255Protein automated matches [190039] (120 species)
    not a true protein
  7. 1881056Species Wolinella succinogenes [TaxId:844] [189100] (1 PDB entry)
  8. 1881057Domain d3k4ua_: 3k4u A: [179080]
    automated match to d1wdna_
    complexed with lys

Details for d3k4ua_

PDB Entry: 3k4u (more details), 2.62 Å

PDB Description: crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
PDB Compounds: (A:) binding component of abc transporter

SCOPe Domain Sequences for d3k4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4ua_ c.94.1.0 (A:) automated matches {Wolinella succinogenes [TaxId: 844]}
lrgelrvglepgylpfemkdkkgnvigfdvdlaremakamgvklklvptswdglipglvt
ekfdiiisgmtisqernlrvnfvepyivvgqsllvkkglekgvksykdldkpeltlvtkf
gvsaeyaakrlfknaklktydteaeavqevlngkadmfifdlpfnvafmaqkgqgylvhl
dtsltyeplgwaikkgdpdflnwlnhflaqikhdgsydelyerwfvdtkwlek

SCOPe Domain Coordinates for d3k4ua_:

Click to download the PDB-style file with coordinates for d3k4ua_.
(The format of our PDB-style files is described here.)

Timeline for d3k4ua_: