SCOPe 2.08: Domain d3k4sa1: 3k4s A:86-412

Lineage for d3k4sa1 (3k4s A:86-412)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries)
   Uniprot Q08499 388-713

8. Domain d3k4sa1: 3k4s A:86-412 [179079]
   Other proteins in same PDB: d3k4sa2
   automated match to d1oyna_
   complexed with 0mo, mg, zn

Details for d3k4sa1

PDB Entry: 3k4s, 2.05 Å

PDB Description: The structure of the catalytic domain of human PDE4d with 4-(3-Butoxy-4-methoxyphenyl)methyl-2-imidazolidone

PDB Compounds: (A:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d3k4sa1:

Sequence; same for both SEQRES and ATOM records:

>d3k4sa1 a.211.1.2 (A:86-412) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipq

Timeline for d3k4sa1:

• d3k4sa1 first appeared in SCOPe 2.01, called d3k4sa_
  
• d3k4sa1 appears in SCOPe 2.07