![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) ![]() |
![]() | Family c.60.1.2: Histidine acid phosphatase [53258] (4 proteins) |
![]() | Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (4 species) |
![]() | Species Aspergillus niger [TaxId:5061] [53265] (3 PDB entries) |
![]() | Domain d3k4qb_: 3k4q B: [179078] automated match to d1ihpa_ complexed with ihs, nag |
PDB Entry: 3k4q (more details), 2.2 Å
SCOPe Domain Sequences for d3k4qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k4qb_ c.60.1.2 (B:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]} scdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhgaryptd skgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikfyqryes ltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvviseasssnnt ldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdmcsfdti ststvdtklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyaneliarlth spvhddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplstttveni tqtdgfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgrctrdsf vrglsfarsggdwaecfa
Timeline for d3k4qb_: