Lineage for d3k4pa_ (3k4p A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128137Family c.60.1.2: Histidine acid phosphatase [53258] (4 protein domains)
  6. 2128142Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (4 species)
  7. 2128151Species Aspergillus niger [TaxId:5061] [53265] (3 PDB entries)
  8. 2128156Domain d3k4pa_: 3k4p A: [179075]
    automated match to d1ihpa_
    complexed with nag

Details for d3k4pa_

PDB Entry: 3k4p (more details), 2.4 Å

PDB Description: Aspergillus niger Phytase
PDB Compounds: (A:) 3-phytase A

SCOPe Domain Sequences for d3k4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4pa_ c.60.1.2 (A:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]}
scdtvdqgyqcfsetshlwgqyapffslanesvispevpagcrvtfaqvlsrhgaryptd
skgkkysalieeiqqnattfdgkyaflktynyslgaddltpfgeqelvnsgikfyqryes
ltrnivpfirssgssrviasgkkfiegfqstklkdpraqpgqsspkidvviseasssnnt
ldpgtctvfedseladtveanftatfvpsirqrlendlsgvtltdtevtylmdmcsfdti
ststvdtklspfcdlfthdewinydylqslkkyyghgagnplgptqgvgyaneliarlth
spvhddtssnhtldsspatfplnstlyadfshdngiisilfalglyngtkplstttveni
tqtdgfssawtvpfasrlyvemmqcqaeqeplvrvlvndrvvplhgcpvdalgrctrdsf
vrglsfarsggdwaecfa

SCOPe Domain Coordinates for d3k4pa_:

Click to download the PDB-style file with coordinates for d3k4pa_.
(The format of our PDB-style files is described here.)

Timeline for d3k4pa_: