SCOPe 2.08: Domain d3k4gf_: 3k4g F:

Lineage for d3k4gf_ (3k4g F:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)

6. Protein automated matches [191020] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189388] (2 PDB entries)

8. Domain d3k4gf_: 3k4g F: [179072]
   automated match to d1cooa_
   complexed with na

Details for d3k4gf_

PDB Entry: 3k4g, 2.05 Å

PDB Description: Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain

PDB Compounds: (F:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3k4gf_:

Sequence; same for both SEQRES and ATOM records:

>d3k4gf_ a.60.3.1 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
vlasrglslgmrlenwppasiade

Timeline for d3k4gf_:

• d3k4gf_ first appeared in SCOPe 2.01
  
• d3k4gf_ appears in SCOPe 2.07