| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins) |
| Protein automated matches [191020] (3 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [189388] (2 PDB entries) |
| Domain d3k4ge_: 3k4g E: [179071] automated match to d1cooa_ complexed with na |
PDB Entry: 3k4g (more details), 2.05 Å
SCOPe Domain Sequences for d3k4ge_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3k4ge_ a.60.3.1 (E:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
vlasrglslgmrlenwppasiad
Timeline for d3k4ge_: