Lineage for d3k4gd_ (3k4g D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715762Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 2715763Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (2 proteins)
  6. 2715775Protein automated matches [191020] (3 species)
    not a true protein
  7. 2715781Species Escherichia coli K-12 [TaxId:83333] [189388] (2 PDB entries)
  8. 2715785Domain d3k4gd_: 3k4g D: [179070]
    automated match to d1cooa_
    complexed with na

Details for d3k4gd_

PDB Entry: 3k4g (more details), 2.05 Å

PDB Description: Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
PDB Compounds: (D:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d3k4gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k4gd_ a.60.3.1 (D:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
vlasrglslgmrlenwppasiad

SCOPe Domain Coordinates for d3k4gd_:

Click to download the PDB-style file with coordinates for d3k4gd_.
(The format of our PDB-style files is described here.)

Timeline for d3k4gd_: