SCOP 1.55: Domain d1exeb_: 1exe B:

Lineage for d1exeb_ (1exe B:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.55: Prokaryotic DNA-bending protein [47728] (1 superfamily)

4. Superfamily a.55.1: Prokaryotic DNA-bending protein [47729] (1 family)

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)

6. Protein Transcription factor 1, TF1 [47738] (1 species)

7. Species Bacteriophage SPO1 (Bacillus subtilis) [TaxId:10685] [47739] (2 PDB entries)

8. Domain d1exeb_: 1exe B: [17907]

Details for d1exeb_

PDB Entry: 1exe

PDB Description: solution structure of a mutant of transcription factor 1.

SCOP Domain Sequences for d1exeb_:

Sequence; same for both SEQRES and ATOM records:

>d1exeb_ a.55.1.1 (B:) Transcription factor 1, TF1 {Bacteriophage SPO1 (Bacillus subtilis)}
mnktelikaiaqdtgltqvsvskmlasfekiitetvakgdkvqltgflnikpvarqarkg
fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak

Timeline for d1exeb_:

• d1exeb_ appears in SCOP 1.57
  
• d1exeb_ appears in the current release, SCOPe 2.08