Lineage for d3k48d_ (3k48 D:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117451Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1117452Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1117453Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1117692Protein automated matches [190204] (3 species)
    not a true protein
  7. 1117713Species Mouse (Mus musculus) [TaxId:10090] [189134] (3 PDB entries)
  8. 1117718Domain d3k48d_: 3k48 D: [179061]
    automated match to d1u5xa_

Details for d3k48d_

PDB Entry: 3k48 (more details), 2.8 Å

PDB Description: Crystal structure of APRIL bound to a peptide
PDB Compounds: (D:) Tumor necrosis factor ligand superfamily member 13

SCOPe Domain Sequences for d3k48d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k48d_ b.22.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
khsvlhlvpvnitskadsdvtevmwqpvlrrgrgleaqgdivrvwdtgiyllysqvlfhd
vtftmgqvvsregqgrretlfrcirsmpsdpdraynscysagvfhlhqgdiitvkipran
aklslsphgtflgfvkl

SCOPe Domain Coordinates for d3k48d_:

Click to download the PDB-style file with coordinates for d3k48d_.
(The format of our PDB-style files is described here.)

Timeline for d3k48d_: