Lineage for d3k47a_ (3k47 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1871771Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1871959Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 1872082Species Mouse (Mus musculus) [TaxId:10090] [187727] (6 PDB entries)
  8. 1872085Domain d3k47a_: 3k47 A: [179058]
    automated match to d1drfa_
    complexed with d09, ndp

Details for d3k47a_

PDB Entry: 3k47 (more details), 2.05 Å

PDB Description: alternate binding modes observed for the e- and z-isomers of 2,4- diaminofuro[2,3-d]pyrimidines as ternary complexes with nadph and mouse dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d3k47a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k47a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Mouse (Mus musculus) [TaxId: 10090]}
vrplncivavsqnmgigkngdlpwpplrnefkyfqrmtttssvegkqnlvimgrktwfsi
peknrplkdrinivlsrelkepprgahflakslddalrlieqpelaskvdmvwivggssv
yqeamnqpghlrlfvtrimqefesdtffpeidlgkykllpeypgvlsevqeekgikykfe
vyekkd

SCOPe Domain Coordinates for d3k47a_:

Click to download the PDB-style file with coordinates for d3k47a_.
(The format of our PDB-style files is described here.)

Timeline for d3k47a_: