Lineage for d3k40a_ (3k40 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132106Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (4 protein domains)
    automatically mapped to Pfam PF00282
  6. 2132168Protein automated matches [191129] (2 species)
    not a true protein
  7. 2132169Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189218] (1 PDB entry)
  8. 2132170Domain d3k40a_: 3k40 A: [179050]
    automated match to d1js3a_
    complexed with gol

Details for d3k40a_

PDB Entry: 3k40 (more details), 1.75 Å

PDB Description: Crystal structure of Drosophila 3,4-dihydroxyphenylalanine decarboxylase
PDB Compounds: (A:) Aromatic-L-amino-acid decarboxylase

SCOPe Domain Sequences for d3k40a_:

Sequence, based on SEQRES records: (download)

>d3k40a_ c.67.1.6 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
meapefkdfaktmvdfiaeylenirerrvlpevkpgylkplipdaapekpekwqdvmqdi
ervimpgvthwhspkfhayfptansypaivadmlsgaiacigftwiaspactelevvmmd
wlgkmlelpaeflacsggkgggviqgtasestlvallgakakklkevkelhpewdehtil
gklvgycsdqahssveragllggvklrsvqsenhrmrgaalekaieqdvaeglipfyavv
tlgttnscafdyldecgpvgnkhnlwihvdaayagsaficpeyrhlmkgiesadsfnfnp
hkwmlvnfdcsamwlkdpswvvnafnvdplylkhdmqgsapdyrhwqiplgrrfralklw
fvlrlygvenlqahirrhcnfakqfgdlcvadsrfelaaeinmglvcfrlkgsnerneal
lkringrghihlvpakikdvyflrmaicsrftqsedmeyswkevsaaademeqeq

Sequence, based on observed residues (ATOM records): (download)

>d3k40a_ c.67.1.6 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
meapefkdfaktmvdfiaeylenirerrvlpevkpgylkplipdaapekpekwqdvmqdi
ervimpgvthwhspkfhayfptansypaivadmlsgaiacigftwiaspactelevvmmd
wlgkmlelpaeflacsggkgggviqgtasestlvallgakakklkevkelhpewdehtil
gklvgycsdqahssveragllggvklrsvqsenhrmrgaalekaieqdvaeglipfyavv
tlgttnscafdyldecgpvgnkhnlwihvdaayagsaficpeyrhlmkgiesadsfnfnp
hkwmlvnfdcsamwlkdpswvplgrrfralklwfvlrlygvenlqahirrhcnfakqfgd
lcvadsrfelaaeinmglvcfrlkgsnerneallkringrghihlvpakikdvyflrmai
csrftqsedmeyswkevsaaademeqeq

SCOPe Domain Coordinates for d3k40a_:

Click to download the PDB-style file with coordinates for d3k40a_.
(The format of our PDB-style files is described here.)

Timeline for d3k40a_: