Lineage for d1wtub_ (1wtu B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715141Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2715142Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2715143Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 2715183Protein Transcription factor 1, TF1 [47738] (1 species)
  7. 2715184Species Bacteriophage SPO1 [TaxId:10685] [47739] (2 PDB entries)
  8. 2715188Domain d1wtub_: 1wtu B: [17905]

Details for d1wtub_

PDB Entry: 1wtu (more details)

PDB Description: transcription factor 1, nmr, minimized average structure
PDB Compounds: (B:) transcription factor 1

SCOPe Domain Sequences for d1wtub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtub_ a.55.1.1 (B:) Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 10685]}
mnktelikaiaqdteltqvsvskmlasfekittetvakgdkvqltgflnikpvarqarkg
fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak

SCOPe Domain Coordinates for d1wtub_:

Click to download the PDB-style file with coordinates for d1wtub_.
(The format of our PDB-style files is described here.)

Timeline for d1wtub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wtua_