Class a: All alpha proteins [46456] (290 folds) |
Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily) core: 4 helices; bundle, partly opened, capped with a beta-sheet |
Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) dimer of identical subunits |
Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins) automatically mapped to Pfam PF00216 |
Protein Transcription factor 1, TF1 [47738] (1 species) |
Species Bacteriophage SPO1 [TaxId:10685] [47739] (2 PDB entries) |
Domain d1wtub_: 1wtu B: [17905] |
PDB Entry: 1wtu (more details)
SCOPe Domain Sequences for d1wtub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wtub_ a.55.1.1 (B:) Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 10685]} mnktelikaiaqdteltqvsvskmlasfekittetvakgdkvqltgflnikpvarqarkg fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak
Timeline for d1wtub_: