SCOPe 2.04: Domain d3k3ua_: 3k3u A:

Lineage for d3k3ua_ (3k3u A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (31 PDB entries)

8. Domain d3k3ua_: 3k3u A: [179048]
   automated match to d1ew6a_
   complexed with hem, so4; mutant

Details for d3k3ua_

PDB Entry: 3k3u, 1.63 Å

PDB Description: the v59w mutation blocks the distal pocket of the hemoglobin dehaloperoxidase from amphitrite ornata

PDB Compounds: (A:) Dehaloperoxidase A

SCOPe Domain Sequences for d3k3ua_:

Sequence; same for both SEQRES and ATOM records:

>d3k3ua_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekwf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3k3ua_:

• d3k3ua_ first appeared in SCOPe 2.01
  
• d3k3ua_ appears in SCOPe 2.03
  
• d3k3ua_ appears in SCOPe 2.05
  
• d3k3ua_ appears in the current release, SCOPe 2.08