Lineage for d3k3lb_ (3k3l B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1799772Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1799930Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)
  7. 1799931Species Human (Homo sapiens) [TaxId:9606] [50836] (34 PDB entries)
  8. 1800021Domain d3k3lb_: 3k3l B: [179045]
    automated match to d1ngla_
    complexed with cl, dbh, dbs, gol, mck, na, so4

Details for d3k3lb_

PDB Entry: 3k3l (more details), 2.62 Å

PDB Description: crystal structure of siderocalin (ngal, lipocalin 2) complexed with apo enterobactin
PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d3k3lb_:

Sequence, based on SEQRES records: (download)

>d3k3lb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
ipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksynvt
svlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvs
qnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg

Sequence, based on observed residues (ATOM records): (download)

>d3k3lb_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
ipapplskvplqqnfqdnqfqgkwyvvglanailmyatiyeldksynvtsvlfrkkkcdy
wirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffkkvsqnreyfkitly
grtkeelkenfirfskslglpevfpvpidqcidg

SCOPe Domain Coordinates for d3k3lb_:

Click to download the PDB-style file with coordinates for d3k3lb_.
(The format of our PDB-style files is described here.)

Timeline for d3k3lb_: