SCOPe 2.08: Domain d1wtua_: 1wtu A:

Lineage for d1wtua_ (1wtu A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein Transcription factor 1, TF1 [47738] (1 species)

7. Species Bacteriophage SPO1 [TaxId:10685] [47739] (2 PDB entries)

8. Domain d1wtua_: 1wtu A: [17904]

Details for d1wtua_

PDB Entry: 1wtu

PDB Description: transcription factor 1, nmr, minimized average structure

PDB Compounds: (A:) transcription factor 1

SCOPe Domain Sequences for d1wtua_:

Sequence; same for both SEQRES and ATOM records:

>d1wtua_ a.55.1.1 (A:) Transcription factor 1, TF1 {Bacteriophage SPO1 [TaxId: 10685]}
mnktelikaiaqdteltqvsvskmlasfekittetvakgdkvqltgflnikpvarqarkg
fnpqtqealeiapsvgvsvkpgeslkkaaeglkyedfak

Timeline for d1wtua_:

• d1wtua_ first appeared (with stable ids) in SCOP 1.55
  
• d1wtua_ appears in SCOPe 2.07