Lineage for d1b8za_ (1b8z A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4185Fold a.55: Prokaryotic DNA-bending protein [47728] (1 superfamily)
  4. 4186Superfamily a.55.1: Prokaryotic DNA-bending protein [47729] (1 family) (S)
  5. 4187Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)
  6. 4192Protein HU protein [47735] (2 species)
  7. 4199Species Thermotoga maritima [TaxId:243274] [47737] (1 PDB entry)
  8. 4200Domain d1b8za_: 1b8z A: [17902]

Details for d1b8za_

PDB Entry: 1b8z (more details), 1.6 Å

PDB Description: hu from thermotoga maritima

SCOP Domain Sequences for d1b8za_:

Sequence, based on SEQRES records: (download)

>d1b8za_ a.55.1.1 (A:) HU protein {Thermotoga maritima}
mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevrkaaarkg
vnpqtrkpitiperkvpkfkpgkalkekvk

Sequence, based on observed residues (ATOM records): (download)

>d1b8za_ a.55.1.1 (A:) HU protein {Thermotoga maritima}
mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevvpkfkpgk
alkekvk

SCOP Domain Coordinates for d1b8za_:

Click to download the PDB-style file with coordinates for d1b8za_.
(The format of our PDB-style files is described here.)

Timeline for d1b8za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b8zb_