SCOPe 2.08: Domain d1b8za_: 1b8z A:

Lineage for d1b8za_ (1b8z A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein HU protein [47735] (5 species)

7. Species Thermotoga maritima [TaxId:2336] [47737] (2 PDB entries)
   Uniprot P36206

8. Domain d1b8za_: 1b8z A: [17902]

Details for d1b8za_

PDB Entry: 1b8z, 1.6 Å

PDB Description: hu from thermotoga maritima

PDB Compounds: (A:) protein (histonelike protein hu)

SCOPe Domain Sequences for d1b8za_:

Sequence, based on SEQRES records:

>d1b8za_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]}
mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevrkaaarkg
vnpqtrkpitiperkvpkfkpgkalkekvk

Sequence, based on observed residues (ATOM records):

>d1b8za_ a.55.1.1 (A:) HU protein {Thermotoga maritima [TaxId: 2336]}
mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevvpkfkpgk
alkekvk

Timeline for d1b8za_:

• d1b8za_ first appeared (with stable ids) in SCOP 1.55
  
• d1b8za_ appears in SCOPe 2.07