SCOP 1.65: Domain d1hueb_: 1hue B:

Lineage for d1hueb_ (1hue B:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)

6. Protein HU protein [47735] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47736] (2 PDB entries)

8. Domain d1hueb_: 1hue B: [17901]

Details for d1hueb_

PDB Entry: 1hue

PDB Description: histone-like protein

SCOP Domain Sequences for d1hueb_:

Sequence; same for both SEQRES and ATOM records:

>d1hueb_ a.55.1.1 (B:) HU protein {Bacillus stearothermophilus}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg
rnpqtgeemeipaskvpafkpgkalkdavk

Timeline for d1hueb_:

• d1hueb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hueb_ appears in SCOP 1.63
  
• d1hueb_ appears in SCOP 1.67
  
• d1hueb_ appears in the current release, SCOPe 2.08