Lineage for d3k38p_ (3k38 P:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2064981Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2064982Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 protein domains)
  6. 2064995Protein Influenza neuraminidase [50943] (4 species)
  7. 2065105Species Influenza B virus, different strains [TaxId:11520] [50945] (18 PDB entries)
  8. 2065138Domain d3k38p_: 3k38 P: [179003]
    automated match to d1a4ga_
    complexed with ca, nag, so4, yt3; mutant

Details for d3k38p_

PDB Entry: 3k38 (more details), 2.19 Å

PDB Description: crystal structure of b/perth neuraminidase d197e mutant
PDB Compounds: (P:) Neuraminidase

SCOPe Domain Sequences for d3k38p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k38p_ b.68.1.1 (P:) Influenza neuraminidase {Influenza B virus, different strains [TaxId: 11520]}
pewtyprlscpgstfqkallisphrfgetkgnsapliirepfiacgpkeckhfalthyaa
qpggyyngtrgdrnklrhlisvklgkiptvensifhmaawsgsachdgkewtyigvdgpe
nnallkikygeaytdtyhsyannilrtqesacnciggncylmitdgsasgisecrflkir
egriikeifptgrvkhteectcgfasnktiecacrdnsytakrpfvklnvetdtaeirlm
ctetyldtprpddgsitgpcesngdkgsggikggfvhqrmaskigrwysrtmsktkrmgm
glyvkydgdpwtdsdalalsgvmvsmeepgwysfgfeikdkkcdvpcigiemvhdggket
whsaataiyclmgsgqllwdtvtgvdmal

SCOPe Domain Coordinates for d3k38p_:

Click to download the PDB-style file with coordinates for d3k38p_.
(The format of our PDB-style files is described here.)

Timeline for d3k38p_: