Lineage for d1huea_ (1hue A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916627Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 916628Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 916629Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
  6. 916630Protein HU protein [47735] (5 species)
  7. 916640Species Bacillus stearothermophilus [TaxId:1422] [47736] (2 PDB entries)
  8. 916644Domain d1huea_: 1hue A: [17900]

Details for d1huea_

PDB Entry: 1hue (more details)

PDB Description: histone-like protein
PDB Compounds: (A:) hu protein

SCOPe Domain Sequences for d1huea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huea_ a.55.1.1 (A:) HU protein {Bacillus stearothermophilus [TaxId: 1422]}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg
rnpqtgeemeipaskvpafkpgkalkdavk

SCOPe Domain Coordinates for d1huea_:

Click to download the PDB-style file with coordinates for d1huea_.
(The format of our PDB-style files is described here.)

Timeline for d1huea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hueb_