SCOPe 2.08: Domain d1huuc_: 1huu C:

Lineage for d1huuc_ (1huu C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein HU protein [47735] (5 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [47736] (2 PDB entries)

8. Domain d1huuc_: 1huu C: [17899]

Details for d1huuc_

PDB Entry: 1huu, 2 Å

PDB Description: dna-binding protein hu from bacillus stearothermophilus

PDB Compounds: (C:) protein hu

SCOPe Domain Sequences for d1huuc_:

Sequence, based on SEQRES records:

>d1huuc_ a.55.1.1 (C:) HU protein {Bacillus stearothermophilus [TaxId: 1422]}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevreraarkg
rnpqtgeemeipaskvpafkpgkalkdavk

Sequence, based on observed residues (ATOM records):

>d1huuc_ a.55.1.1 (C:) HU protein {Bacillus stearothermophilus [TaxId: 1422]}
mnktelinavaetsglskkdatkavdavfdsitealrkgdkvqligfgnfevrerkvpaf
kpgkalkdavk

Timeline for d1huuc_:

• d1huuc_ first appeared (with stable ids) in SCOP 1.55
  
• d1huuc_ appears in SCOPe 2.07